PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast09G156400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 341aa    MW: 38905.8 Da    PI: 6.7573
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast09G156400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.8e-5471361129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPtdeelv++yL+kkv+ k+++l ++ik+vd+yk+ePwd+++  k+ + ++++w+fFs++dkky+tg+r+nrat++g+Wkatg+
  Brast09G156400.1.p   7 VPPGFRFHPTDEELVDYYLRKKVAFKSIDL-DIIKDVDLYKIEPWDIQEqcKIGTeDQNDWFFFSHKDKKYPTGTRTNRATTAGFWKATGR 96 
                         69****************************.99**************953444442455******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         dk++++ k+ lvg++ktLvfykgrap+g+k+dW+mheyrle
  Brast09G156400.1.p  97 DKPIYV-KHCLVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                         ******.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-595156IPR003441NAC domain
PROSITE profilePS5100557.7667156IPR003441NAC domain
PfamPF023656.2E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MNAFSHVPPG FRFHPTDEEL VDYYLRKKVA FKSIDLDIIK DVDLYKIEPW DIQEQCKIGT  60
EDQNDWFFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YVKHCLVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GAPHDEGWVV CKVFKKRVAT VQRMATDSPF WVNDHVAFMA  180
PHVDSPRQAM HHLQNALYNG HQQSYHHHPC KVELEYHHLL PQEPMSFLQL PQLESPRLPD  240
LIGAVATLQQ PCILTRNDQA SSQELQIDPV YVTDASAAGD WRDLDKFMAS QLISHGDSIP  300
KECSYSNPAK AFQVEQGKQE EALDYVSTSA SGGGGSDLWK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934230.0JQ693423.1 Brachypodium distachyon SWN2 (SWN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001266823.10.0uncharacterized protein LOC100845863
RefseqXP_010239582.10.0PREDICTED: uncharacterized protein LOC100845863 isoform X1
SwissprotQ9FWX21e-122NAC7_ARATH; NAC domain-containing protein 7
TrEMBLI1J0390.0I1J039_BRADI; SWN2
STRINGBRADI5G16917.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-113NAC 007